HBYCSC Technology Co., Ltd

HBYCSC Technology Co., Ltd

You are here: HomeProductsSermorelin CAS: 86168-78-7

Contact us

  • Company Name: HBYCSC Technology Co., Ltd
  • Street: 496 Zhongshan Road, Wuchang District, Wuhan, Hubei,China
  • City: Wuhan
  • Province/state: Hubei
  • Country/region: China
  • Contact Person: Mr.Tom Bryant
  • Department: Sales
  • Tel: 86-27-50756049
  • Fax: 86-27-68886696
  • Email:

Sermorelin CAS: 86168-78-7

  • CAS No:86168-78-7 Sermorelin
    Molecular Structure

    Detailed Description

    Sermorelin CAS: 86168-78-7

    Product Name: Sermorelin
    Synonyms: SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
    CAS: 86168-78-7
    MF: C149H246N44O42S
    MW: 3357.88
    Product Categories: Amino Acid Derivatives;Peptide;GH-RHObesity Research;GH-RHPeptides for Cell Biology;Growth Hormone Releasing Factors;Neuropeptides;Neurotransmission (Obesity);Releasing Factors
    Storage temp. below 20°C
    Usage xanthine oxidase inhibitor
    -------------------------------- Additional Information -------------------------------
    Place of origin : China
    Brand : YC
    Certificate : ISO9001-2008, KOSHER, GMP, SGS
    Minimum order quantity : 5 Grams
    Production capacity : 1000 Kilograms/Month

    -------------------------------- Delivery Information ---------------------------------
    Packing : Foil bag/tin or as your request
    Payment : T/T, Western Union, MoneyGram
    Port : Shanghai, Shenzhen, Hongkong
    Shipment method : EMS, DHL, FeDex, UPS, etc
    Leading time : Within 24 hours after payment
    Delivery time : Within 6 business days after payment (door to door service)

    -------------------------------- Our Competitive Advantages ---------------------------
    1. Professionalism : We specialized in exporting peptide for 15 years, you must want to find a professional partner like us
    2. Quality: Our company is a professional leading factory in China in pharmaceutical area, We had stable customers and exported to Germany, Spain, UK, USA, Australia, Middle East, and any other countries. We can provide good references about our company. As for the quality of the products, we are sure you will be satisfied with it
    3. Package: Professional packing with professional materials (High rate of customs clearance)
    4. Delivery: We have products in stock, and we will deliver them soon after payment. Meanwhile we will give you the tracking number in order to make you know the exact location of the products. We will keep track of the product until they arrive you; We choose the best courier service for you, and with the delivery around 5-7 working days
    5. Service: Best Service with after-sales service and consultation

    -------------------------------- Product list ---------------------------
    MGF 2mg/vials, 10 vials/box
    PEG MGF 2mg/vials, 10 vials/box
    CJC-1295 with DAC 2mg/vials, 10 vials/box
    CJC-1295 without DAC 2mg/vials, 10 vials/box
    PT-141 10mg/vials, 10 vials/box
    MT-1 10mg/vials, 10 vials/box
    MT-2 10mg/vials, 10 vials/box
    GHRP-2 5mg/vials, 10 vials/box
    GHRP-2 10mg/vials, 10 vials/box
    GHRP-6 5mg/vials, 10 vials/box
    GHRP-6 10mg/vials, 10 vials/box
    Ipamorelin 2mg/vials, 10 vials/box
    Hexarelin 2mg/vials, 10 vials/box
    Sermorelin 2mg/vials, 10 vials/box
    Oxytocin 2mg/vials, 10 vials/box
    TB500 2mg/vials, 10 vials/box
    pentadecapeptide BPC 157 2mg/vials, 10 vials/box
    Hgh 176-191 2mg/vials, 10 vials/box
    Triptorelin 2mg/vials, 10 vials/box
    Tesamorelin 2mg/vials, 10 vials/box
    Gonadorelin 2mg/vials, 10 vials/box
    Gonadorelin 10mg/vials, 10 vials/box
    DSIP 2mg/vials, 10 vials/box
    Selank 5mg/vials, 10 vials/box
  • Sermorelin   CAS: 86168-78-7
  • Sermorelin CAS: 86168-78-7