Sermorelin CAS: 86168-78-7
-
Molecular Structure
Detailed Description
Sermorelin CAS: 86168-78-7
Product Name: Sermorelin
Synonyms: SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
CAS: 86168-78-7
MF: C149H246N44O42S
MW: 3357.88
Product Categories: Amino Acid Derivatives;Peptide;GH-RHObesity Research;GH-RHPeptides for Cell Biology;Growth Hormone Releasing Factors;Neuropeptides;Neurotransmission (Obesity);Releasing Factors
Storage temp. below 20°C
Usage xanthine oxidase inhibitor
-------------------------------- Additional Information -------------------------------
Place of origin : China
Brand : YC
Certificate : ISO9001-2008, KOSHER, GMP, SGS
Minimum order quantity : 5 Grams
Production capacity : 1000 Kilograms/Month
-------------------------------- Delivery Information ---------------------------------
Packing : Foil bag/tin or as your request
Payment : T/T, Western Union, MoneyGram
Port : Shanghai, Shenzhen, Hongkong
Shipment method : EMS, DHL, FeDex, UPS, etc
Leading time : Within 24 hours after payment
Delivery time : Within 6 business days after payment (door to door service)
-------------------------------- Our Competitive Advantages ---------------------------
1. Professionalism : We specialized in exporting peptide for 15 years, you must want to find a professional partner like us
2. Quality: Our company is a professional leading factory in China in pharmaceutical area, We had stable customers and exported to Germany, Spain, UK, USA, Australia, Middle East, and any other countries. We can provide good references about our company. As for the quality of the products, we are sure you will be satisfied with it
3. Package: Professional packing with professional materials (High rate of customs clearance)
4. Delivery: We have products in stock, and we will deliver them soon after payment. Meanwhile we will give you the tracking number in order to make you know the exact location of the products. We will keep track of the product until they arrive you; We choose the best courier service for you, and with the delivery around 5-7 working days
5. Service: Best Service with after-sales service and consultation
-------------------------------- Product list ---------------------------
MGF 2mg/vials, 10 vials/box
PEG MGF 2mg/vials, 10 vials/box
CJC-1295 with DAC 2mg/vials, 10 vials/box
CJC-1295 without DAC 2mg/vials, 10 vials/box
PT-141 10mg/vials, 10 vials/box
MT-1 10mg/vials, 10 vials/box
MT-2 10mg/vials, 10 vials/box
GHRP-2 5mg/vials, 10 vials/box
GHRP-2 10mg/vials, 10 vials/box
GHRP-6 5mg/vials, 10 vials/box
GHRP-6 10mg/vials, 10 vials/box
Ipamorelin 2mg/vials, 10 vials/box
Hexarelin 2mg/vials, 10 vials/box
Sermorelin 2mg/vials, 10 vials/box
Oxytocin 2mg/vials, 10 vials/box
TB500 2mg/vials, 10 vials/box
pentadecapeptide BPC 157 2mg/vials, 10 vials/box
Hgh 176-191 2mg/vials, 10 vials/box
Triptorelin 2mg/vials, 10 vials/box
Tesamorelin 2mg/vials, 10 vials/box
Gonadorelin 2mg/vials, 10 vials/box
Gonadorelin 10mg/vials, 10 vials/box
DSIP 2mg/vials, 10 vials/box
Selank 5mg/vials, 10 vials/box
- Sermorelin CAS: 86168-78-7